PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2506_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bHLH
Protein Properties Length: 175aa    MW: 20113 Da    PI: 8.8528
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2506_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH46.47.3e-152576255
                HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
         HLH  2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                + +h e+E++RR+++ s ++ Lr+llP  +   +++ s ++ L +Av+YI++Lq
  RrC2506_p2 25 KIMHREVEKQRRQEMSSLYASLRSLLPLEF--IQGRRSTSDQLNEAVNYINHLQ 76
                568*************************65..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474593.53E-142390IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.8212375IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.78E-102580No hitNo description
PfamPF000108.3E-122676IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.106.6E-122790IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003536.1E-72981IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MADFPEKGRK RRKEARVGNE ENMEKIMHRE VEKQRRQEMS SLYASLRSLL PLEFIQGRRS  60
TSDQLNEAVN YINHLQRNIK DMSSKRDDLM LLSGQSFESK NEQSRSDNSN HVMIRPCLVG  120
VEIVFSVLQT PLSSVLHVLS EYGLCVLGCI SSNVNGRLIH TLQAEVRTIY LVHNL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1813RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894154e-35AC189415.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB061L05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013738057.11e-109PREDICTED: transcription factor bHLH118-like isoform X1
RefseqXP_013738055.11e-109PREDICTED: transcription factor bHLH118-like isoform X1
RefseqXP_009137522.11e-109PREDICTED: transcription factor bHLH118 isoform X1
SwissprotQ9STJ75e-76BH118_ARATH; Transcription factor bHLH118
TrEMBLA0A078IIB11e-109A0A078IIB1_BRANA; BnaA03g47370D protein
TrEMBLM4DRM41e-109M4DRM4_BRARP; Uncharacterized protein
STRINGBra019167.1-P1e-109(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44792754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25400.13e-77bHLH family protein